DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and CG5810

DIOPT Version :9

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:460 Identity:104/460 - (22%)
Similarity:202/460 - (43%) Gaps:62/460 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTRRILEVIVILILAISSCDGSGGDIPLRCDEYDSMGYMDVNEAFCTVTGFTVTHSQNVVIKNIP 67
            |....|..|:|.::|.::|:..      :.:|. ::..:|..|..||...:....:.....:|: 
  Fly     2 RMLNYLNYILIAVIAFATCESQ------KLEEI-AIDSLDCRENTCTNLKYPSASAVAYFSENV- 58

  Fly    68 PGNMVKFMKFYESTLLY------MPFHLFETFPYLKTLDVSNTNILELTRNAFSAASNLTYLNLA 126
                .|.::.||:.:|:      :|..:|...|.|....|....:.::....|..|.||..||..
  Fly    59 ----TKHLRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFG 119

  Fly   127 YNNLTSIQTSVFIGANVLMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEY 191
            .|.|..:.::.|..|..|..|:||.|::..|....|..|..:.:|.|:.|.|..|...||.....
  Fly   120 GNALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFSQLGS 184

  Fly   192 LEKVSFEGNLLTSIQPEVFRNMRR-IKEVNLSNNRLIFIHPDTFADAASLENLVLSYN-ELKNFQ 254
            |:.::.:.|.|..:..|:||:.|: :.|.:..:|:|:.|..:.|.:   :::|.||:| :|:...
  Fly   185 LKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFRE---IDHLSLSFNPQLRRLH 246

  Fly   255 LTEKNIVHQLHLDNNYLTNLTINATRFVRA---SHNQISELFLHQSLHIETLDLSANKLSSISNI 316
            |:.|  :::|...|..|.::.::. |.:..   ::.::.||.:.|...:|.|.|:...|..:..:
  Fly   247 LSAK--INELEATNCDLESVELDG-RVIGVQLEANPKLHELKISQPQDLEHLYLANTNLYRLDFL 308

  Fly   317 TNITHMLYLDVSDNPIGPLNISTFSQLKRLRGLNLRGTGIRELKFGMFSKQKYLEELDLSFNNLT 381
            :..:.::.|||:|    .:|::...::...:|                     ||.|..:::|||
  Fly   309 SKASKLVDLDVTD----IVNLADLPKITSAKG---------------------LERLSFTYDNLT 348

  Fly   382 ILNLDMFVPYLTNLKKFLIDGNGLTELQGNRTFSEAFPQLQKLGVSRNRFNCSYLHHLLIPPSLP 446
            ..::|| :|:|.:|....|     :..:|...|.:...  :...|.....||..|..||....||
  Fly   349 SNHMDM-LPHLKDLNYLEI-----SHEKGKEIFIKDLD--EDFFVEEAELNCGQLADLLEFVELP 405

  Fly   447 ESVVL 451
            :...:
  Fly   406 KDTTI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 4/22 (18%)
LRR_8 118..178 CDD:290566 19/59 (32%)
leucine-rich repeat 120..143 CDD:275380 7/22 (32%)
leucine-rich repeat 144..167 CDD:275380 8/22 (36%)
leucine-rich repeat 168..191 CDD:275380 7/22 (32%)
LRR_8 192..250 CDD:290566 16/59 (27%)
leucine-rich repeat 192..215 CDD:275380 6/22 (27%)
LRR_RI <207..432 CDD:238064 48/229 (21%)
leucine-rich repeat 216..239 CDD:275380 5/22 (23%)
leucine-rich repeat 240..299 CDD:275380 14/62 (23%)
LRR_8 299..356 CDD:290566 10/56 (18%)
leucine-rich repeat 300..321 CDD:275380 4/20 (20%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 344..405 CDD:290566 13/60 (22%)
leucine-rich repeat 346..365 CDD:275380 1/18 (6%)
leucine-rich repeat 370..394 CDD:275380 10/23 (43%)
leucine-rich repeat 395..420 CDD:275380 4/24 (17%)
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 18/59 (31%)
leucine-rich repeat 89..112 CDD:275380 4/22 (18%)
leucine-rich repeat 113..136 CDD:275380 7/22 (32%)
LRR_8 135..195 CDD:290566 17/59 (29%)
LRR_4 135..175 CDD:289563 12/39 (31%)
leucine-rich repeat 137..160 CDD:275380 8/22 (36%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
leucine-rich repeat 185..209 CDD:275380 7/23 (30%)
leucine-rich repeat 210..231 CDD:275380 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.