| Sequence 1: | NP_001261934.1 | Gene: | CG4950 / 39783 | FlyBaseID: | FBgn0036587 | Length: | 574 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650740.1 | Gene: | CG7702 / 42242 | FlyBaseID: | FBgn0038638 | Length: | 537 | Species: | Drosophila melanogaster |
| Alignment Length: | 363 | Identity: | 93/363 - (25%) |
|---|---|---|---|
| Similarity: | 155/363 - (42%) | Gaps: | 84/363 - (23%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 96 LKTLDVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQ--TSVFIGA-NVLMRLDLSYNEISSL 157
Fly 158 SVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLTSIQPEVFRNMRRIKEVNLS 222
Fly 223 NNRLIFIHPDTFADAASLENLVLSYN-ELKNFQLTE----KNIVHQLHLDNNYLTNLTINATRFV 282
Fly 283 RASHNQISELF------------------LHQSL------HI-----------ETLDLSANKLSS 312
Fly 313 ISNIT--NITHML----YLDVSDNP---------------------IG-PLNISTFSQLKRLRGL 349
Fly 350 N-----LRGTGIRELKFGMFSKQKYLEELDLS--FNNL 380 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4950 | NP_001261934.1 | leucine-rich repeat | 96..119 | CDD:275380 | 8/22 (36%) |
| LRR_8 | 118..178 | CDD:290566 | 25/62 (40%) | ||
| leucine-rich repeat | 120..143 | CDD:275380 | 13/25 (52%) | ||
| leucine-rich repeat | 144..167 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 168..191 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 192..250 | CDD:290566 | 12/58 (21%) | ||
| leucine-rich repeat | 192..215 | CDD:275380 | 4/22 (18%) | ||
| LRR_RI | <207..432 | CDD:238064 | 56/249 (22%) | ||
| leucine-rich repeat | 216..239 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 240..299 | CDD:275380 | 24/87 (28%) | ||
| LRR_8 | 299..356 | CDD:290566 | 22/100 (22%) | ||
| leucine-rich repeat | 300..321 | CDD:275380 | 10/33 (30%) | ||
| leucine-rich repeat | 322..345 | CDD:275380 | 6/48 (13%) | ||
| LRR_8 | 344..405 | CDD:290566 | 12/44 (27%) | ||
| leucine-rich repeat | 346..365 | CDD:275380 | 5/23 (22%) | ||
| leucine-rich repeat | 370..394 | CDD:275380 | 4/13 (31%) | ||
| leucine-rich repeat | 395..420 | CDD:275380 | |||
| CG7702 | NP_650740.1 | leucine-rich repeat | 110..131 | CDD:275380 | |
| LRR_RI | <123..267 | CDD:238064 | 34/100 (34%) | ||
| leucine-rich repeat | 132..165 | CDD:275380 | |||
| LRR_8 | 165..227 | CDD:290566 | 28/60 (47%) | ||
| leucine-rich repeat | 166..189 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 190..213 | CDD:275380 | 12/22 (55%) | ||
| LRR_8 | 216..273 | CDD:290566 | 13/56 (23%) | ||
| leucine-rich repeat | 217..240 | CDD:275380 | 10/22 (45%) | ||
| leucine-rich repeat | 241..264 | CDD:275380 | 2/22 (9%) | ||
| LRR_8 | 263..321 | CDD:290566 | 11/57 (19%) | ||
| leucine-rich repeat | 265..288 | CDD:275380 | 4/22 (18%) | ||
| leucine-rich repeat | 289..312 | CDD:275380 | 3/22 (14%) | ||
| leucine-rich repeat | 313..337 | CDD:275380 | 7/23 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||