DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4950 and CG18095

DIOPT Version :9

Sequence 1:NP_001261934.1 Gene:CG4950 / 39783 FlyBaseID:FBgn0036587 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_001188805.1 Gene:CG18095 / 34823 FlyBaseID:FBgn0028872 Length:564 Species:Drosophila melanogaster


Alignment Length:421 Identity:115/421 - (27%)
Similarity:203/421 - (48%) Gaps:47/421 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TLLYMPFHLFETFPYLKTLDVSNTNILELTRNAFSAASNLTYLNLAYNNLTSIQ--TSVFIGANV 143
            ||.::....|..|.:|..|::.::.:.:|...:.:..:.|.||:|::|||:|::  :|..:||  
  Fly    50 TLPHVENGFFVRFDHLLHLELQHSGLSDLDDFSLNGLTKLQYLSLSHNNLSSLRSWSSEPLGA-- 112

  Fly   144 LMRLDLSYNEISSLSVNAFCGLHTISQIYLTGNLLKELHNDIFKDNEYLEKVSFEGNLLTSIQPE 208
            |..||||:|.:|.|||.:|.....:.|:.|..|.:.::.||.|....:|:.:...||.|..|...
  Fly   113 LTNLDLSHNMLSKLSVKSFEQYPQLQQLDLRYNRISQIENDSFDGLSHLKHLYLNGNQLAHIDGS 177

  Fly   209 VFRNMRRIKEVNLSNNRLIFIHPDTFADAASLENLVLSYNELKNFQ-LTEKNIVHQLHLDNNYLT 272
            .||.:.|:..::|.:||:.||..|:|.....|.:|.|..|.|.:.| |:::.:...:||  |..:
  Fly   178 FFRGLHRLSSLSLQHNRIEFIEMDSFESNTHLRSLRLDQNLLSSLQFLSQRGLARLVHL--NLSS 240

  Fly   273 NLTINATRFVRA----------SHNQISEL---FLHQSLHIETLDLSANKLSSI--SNITNITHM 322
            ||......||.:          |:|.|::|   .|.....:|.|::|.|.:..|  .::.::..:
  Fly   241 NLLQKLEPFVFSKNFELQDLDLSYNNITKLNKEALSGLDSLERLNISHNYVDKIYDESLDSLIAL 305

  Fly   323 LYLDVSDNPIGPLNISTFSQLKRLRGLNLRGTGIRELKFGMFSKQKYLEELDLSFNNLT-ILNLD 386
            |.||:|.|.:..|..:.|....:|..:.|....|.|:...|...|.:|..:.||.|.:: ...||
  Fly   306 LQLDISFNLLTTLPDNLFHFNTQLEEIILANNKIEEISSQMMFNQNHLRYIKLSGNAISDAAFLD 370

  Fly   387 MFVPYLTNLKKFLIDGNGLTELQGNRTFS---EAFPQLQKLGVSRNRFNCSYLHHLLIPPSLPES 448
            ...|   ::.:|.:    ..:|..||..|   .:....:.:.::.|.::|::|...|: ..||.|
  Fly   371 RLSP---SVNRFTL----YVDLSSNRLKSLNLSSLLHFRYINLADNNWSCNWLVANLV-QKLPNS 427

  Fly   449 V-------VLNIEPDTNLDE-TPHIRDVSCI 471
            |       |:|     ||.| |.::..:.||
  Fly   428 VNFARPWTVIN-----NLSENTTNVEGIDCI 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4950NP_001261934.1 leucine-rich repeat 96..119 CDD:275380 3/22 (14%)
LRR_8 118..178 CDD:290566 25/61 (41%)
leucine-rich repeat 120..143 CDD:275380 11/24 (46%)
leucine-rich repeat 144..167 CDD:275380 11/22 (50%)
leucine-rich repeat 168..191 CDD:275380 6/22 (27%)
LRR_8 192..250 CDD:290566 19/57 (33%)
leucine-rich repeat 192..215 CDD:275380 7/22 (32%)
LRR_RI <207..432 CDD:238064 60/244 (25%)
leucine-rich repeat 216..239 CDD:275380 7/22 (32%)
leucine-rich repeat 240..299 CDD:275380 19/72 (26%)
LRR_8 299..356 CDD:290566 14/58 (24%)
leucine-rich repeat 300..321 CDD:275380 5/22 (23%)
leucine-rich repeat 322..345 CDD:275380 7/22 (32%)
LRR_8 344..405 CDD:290566 14/61 (23%)
leucine-rich repeat 346..365 CDD:275380 5/18 (28%)
leucine-rich repeat 370..394 CDD:275380 7/24 (29%)
leucine-rich repeat 395..420 CDD:275380 5/27 (19%)
CG18095NP_001188805.1 leucine-rich repeat 41..64 CDD:275380 4/13 (31%)
LRR_8 64..123 CDD:290566 20/60 (33%)
leucine-rich repeat 65..88 CDD:275380 3/22 (14%)
leucine-rich repeat 89..112 CDD:275380 9/22 (41%)
leucine-rich repeat 113..136 CDD:275380 11/22 (50%)
LRR_RI 115..384 CDD:238064 76/277 (27%)
LRR_8 135..195 CDD:290566 16/59 (27%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
leucine-rich repeat 161..184 CDD:275380 7/22 (32%)
LRR_8 184..243 CDD:290566 19/60 (32%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..232 CDD:275380 7/22 (32%)
LRR_8 232..289 CDD:290566 15/58 (26%)
leucine-rich repeat 233..256 CDD:275380 7/24 (29%)
leucine-rich repeat 257..280 CDD:275380 5/22 (23%)
LRR_8 280..339 CDD:290566 14/58 (24%)
leucine-rich repeat 281..304 CDD:275380 5/22 (23%)
leucine-rich repeat 305..328 CDD:275380 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BF9C
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.