DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)72Dr and GGH

DIOPT Version :9

Sequence 1:NP_730120.1 Gene:l(3)72Dr / 39778 FlyBaseID:FBgn0263608 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_003869.1 Gene:GGH / 8836 HGNCID:4248 Length:318 Species:Homo sapiens


Alignment Length:314 Identity:96/314 - (30%)
Similarity:172/314 - (54%) Gaps:31/314 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PTVGVMCIDIATQLQQNFSGAYHSYLAASYVKFLEASGAHVVPIWIGRERAYYALMMSQLNGILL 80
            |.:|::......::.:|: |.|  |:||||||:||::||.|||:.:......|.::...:||||.
Human    34 PIIGILMQKCRNKVMKNY-GRY--YIAASYVKYLESAGARVVPVRLDLTEKDYEILFKSINGILF 95

  Fly    81 PGGAVFIDEADRQANPDVTSDCVRSAELIYQLAMERNMRAKKLDDRGAYFPVWGTCLGF-QLILI 144
            |||:|.:..          ||..:.|::.|.|:::      ..|| |.||||||||||| :|.|:
Human    96 PGGSVDLRR----------SDYAKVAKIFYNLSIQ------SFDD-GDYFPVWGTCLGFEELSLL 143

  Fly   145 HAAEAPNVRIACQPMREAMPVTLTDDYQQSQLLGSLPKSVADEMEKHPFACHQHRYCIT-KESLE 208
            .:.|.  :..|...:..|||:..|.....|::..:.|..:...:...|...:.|::.:: |....
Human   144 ISGEC--LLTATDTVDVAMPLNFTGGQLHSRMFQNFPTELLLSLAVEPLTANFHKWSLSVKNFTM 206

  Fly   209 SYGLAKDWHPLATQKDTSGLEFITIVEHRRFPIFGCQFHPERAAFEQLFNSPDKCYMAHSRMGID 273
            :..|.|.::.|.|..| ..:|||:.:|..::|::|.|:|||:|.:|  :.:.|.  ::|:...:.
Human   207 NEKLKKFFNVLTTNTD-GKIEFISTMEGYKYPVYGVQWHPEKAPYE--WKNLDG--ISHAPNAVK 266

  Fly   274 LSQIFGSRFVDFCRRNNNQFESDKLKTRHLIWNWQPVFSGKFKGSNWQQCYLFE 327
            .:......||:..|:||:.|:|:..:.:.||:.:.|:::|..  |::||||:|:
Human   267 TAFYLAEFFVNEARKNNHHFKSESEEEKALIYQFSPIYTGNI--SSFQQCYIFD 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)72DrNP_730120.1 GATase1_Glutamyl_Hydrolase 23..313 CDD:153218 87/291 (30%)
GGHNP_003869.1 GATase1_Glutamyl_Hydrolase 36..306 CDD:153218 88/296 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155326
Domainoid 1 1.000 138 1.000 Domainoid score I4852
eggNOG 1 0.900 - - E1_KOG1559
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7038
OMA 1 1.010 - - QHG54943
OrthoDB 1 1.010 - - D539287at33208
OrthoFinder 1 1.000 - - FOG0002965
OrthoInspector 1 1.000 - - otm40939
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11315
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5199
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.