DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and NUT2

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_015494.1 Gene:NUT2 / 856297 SGDID:S000006372 Length:157 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:34/128 - (26%)
Similarity:62/128 - (48%) Gaps:21/128 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LENLETQLEMFIENVRQIRIIVSDF--QPQGQNVLNQKINSLVTGLQ-EIDKL----------RS 56
            |...:.|:...||:..::.:.:.||  .|:.       ...::|.|| .:|:|          :|
Yeast    15 LATTQDQVASIIESFVELGVSIYDFPGTPEA-------TKGMITNLQRNVDRLYKLNVRSNDPQS 72

  Fly    57 QVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFP 119
            .:..|.:|.|| ..||:..:||.:||::.||.....|:..:||:.|||:.:.:|..::...||
Yeast    73 SLSKVDIPLEV-VQYIEDGRNPDIYTREFVEAIRRSNQYQRGKMHGLKQLRDSLADKIVDEFP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 33/124 (27%)
NUT2NP_015494.1 Med10 19..142 CDD:401627 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I2930
eggNOG 1 0.900 - - E1_KOG3046
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I1846
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004338
OrthoInspector 1 1.000 - - oto100275
orthoMCL 1 0.900 - - OOG6_103658
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R703
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.890

Return to query results.
Submit another query.