DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and BUD27

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_683715.1 Gene:BUD27 / 850521 SGDID:S000001871 Length:796 Species:Saccharomyces cerevisiae


Alignment Length:169 Identity:31/169 - (18%)
Similarity:56/169 - (33%) Gaps:72/169 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IRIIVSDFQPQGQNVLNQKINSLVTGL-----------------------QEIDKLRSQVQDVYV 63
            :||...|:...|.| |:..:.:...||                       ::::.||.:::|..:
Yeast   632 VRITNVDYHALGGN-LDDMVKAYSLGLYDDDLEEDPGTIVEKLEDFKEYNKQVELLRDEIRDFQL 695

  Fly    64 PFE-VFFDYIDQDKN----------PQLYTKDCVEKAL---AKNEEV------------------ 96
            ..: |..:..:.|.|          |:.||.|..|.||   ...|||                  
Yeast   696 ENKPVTMEEEENDGNVMNDIIEHEFPESYTNDEDEVALHPGRLQEEVAIEYRRLKEATASKWQSS 760

  Fly    97 ------KGKIEGLKKFKTNLLLELYKTFPNEMNNYRAYR 129
                  :|::|.:.||..          |.:.:.:|:.|
Yeast   761 SPAAHTEGELEPIDKFGN----------PVKTSRFRSQR 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 29/165 (18%)
BUD27NP_683715.1 Prefoldin 8..121 CDD:397237
DUF3835 714..788 CDD:403972 16/83 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.