DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and AT1G26665

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_564254.1 Gene:AT1G26665 / 839207 AraportID:AT1G26665 Length:189 Species:Arabidopsis thaliana


Alignment Length:130 Identity:46/130 - (35%)
Similarity:73/130 - (56%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ENLE---TQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPFEV 67
            |||.   ..:|..:..:.|:.:.|:.|.|..|..|.|::||||..|..:.|| |:..::.:|.||
plant    37 ENLSQVINSIEKTLGVLHQLHLTVTSFTPASQLHLLQRLNSLVMELDNMTKL-SEKCNIQIPMEV 100

  Fly    68 FFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFPNEMNNYRAYRKDS 132
             .:.||..|||..:|||.:...:|:|:..|||.:..|..:.::|.||.:.||:|::.||..|..|
plant   101 -LNLIDDGKNPDEFTKDVLNSCIARNQVTKGKTDAFKDLRKHILEELEQNFPDEVDMYREIRASS 164

  Fly   133  132
            plant   165  164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 40/120 (33%)
AT1G26665NP_564254.1 Med10 44..158 CDD:286791 39/115 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I3105
eggNOG 1 0.900 - - E1_KOG3046
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2384
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403581at2759
OrthoFinder 1 1.000 - - FOG0004338
OrthoInspector 1 1.000 - - otm3144
orthoMCL 1 0.900 - - OOG6_103658
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.