DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and med10

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001017699.1 Gene:med10 / 550394 ZFINID:ZDB-GENE-070117-2423 Length:134 Species:Danio rerio


Alignment Length:131 Identity:78/131 - (59%)
Similarity:100/131 - (76%) Gaps:1/131 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPF 65
            |:...:|||..||.|:||:||:.||||||||..|..||||:|.::||||:|:|.|.|:.|:.||.
Zfish     1 MAEKFDNLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFVITGLQDIEKCRQQLHDINVPL 65

  Fly    66 EVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFPNEMNNYRAYRK 130
            || |:||||.:|||||||:|:|:||||||:|||||:.|.|||:.|:.||.|.||.||..|:|...
Zfish    66 EV-FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTLTKFKSLLISELGKVFPEEMAKYKAIHG 129

  Fly   131 D 131
            |
Zfish   130 D 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 73/117 (62%)
med10NP_001017699.1 Med10 9..126 CDD:286791 73/117 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 151 1.000 Domainoid score I4341
eggNOG 1 0.900 - - E1_KOG3046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44533
Inparanoid 1 1.050 160 1.000 Inparanoid score I4222
OMA 1 1.010 - - QHG52837
OrthoDB 1 1.010 - - D1403581at2759
OrthoFinder 1 1.000 - - FOG0004338
OrthoInspector 1 1.000 - - oto41123
orthoMCL 1 0.900 - - OOG6_103658
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R703
SonicParanoid 1 1.000 - - X5428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.