DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and Uxt

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001260464.1 Gene:Uxt / 34893 FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster


Alignment Length:105 Identity:25/105 - (23%)
Similarity:48/105 - (45%) Gaps:19/105 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LNQKINSLVTGLQEIDKLRSQVQDVYVPFEVFFDYIDQDKNPQLYTKDCVEKALAK-NEEVKGKI 100
            :|.|.|:......|.|..::::..:    |.|.:.:.::...:|      ||.:.: |||:...:
  Fly     3 VNPKHNTEAHRQAEQDANKARITQI----EEFINEVLKEDLREL------EKCIGQYNEEIMEYV 57

  Fly   101 E---GLKKFKTNLLLELYKTFPNEMNNY----RAYRKDSM 133
            :   .|:.|.|: |.:.|||..|..:|.    |..:.||:
  Fly    58 QLKNTLQTFDTH-LPDGYKTQVNIGSNVFMQARVRKMDSI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 22/97 (23%)
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.