DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and Med10

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:XP_006517338.1 Gene:Med10 / 28077 MGIID:106331 Length:183 Species:Mus musculus


Alignment Length:108 Identity:65/108 - (60%)
Similarity:86/108 - (79%) Gaps:1/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPLENLETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPF 65
            |:...::||..||.|:||:||:.||||||||..|..|:||:|.:|||||:|||.|.|:.|:.||.
Mouse    30 MAEKFDHLEEHLEKFVENIRQLGIIVSDFQPSSQAGLSQKLNFIVTGLQDIDKCRQQLHDITVPL 94

  Fly    66 EVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKT 108
            || |:||||.:|||||||:|:|:||||||:|||||:.:|..:|
Mouse    95 EV-FEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKVRQT 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 63/100 (63%)
Med10XP_006517338.1 Med10 40..>132 CDD:370657 60/92 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 153 1.000 Domainoid score I4294
eggNOG 1 0.900 - - E1_KOG3046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44533
Inparanoid 1 1.050 159 1.000 Inparanoid score I4242
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52837
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004338
OrthoInspector 1 1.000 - - oto95120
orthoMCL 1 0.900 - - OOG6_103658
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R703
SonicParanoid 1 1.000 - - X5428
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.