DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and nut2

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_596571.2 Gene:nut2 / 2540272 PomBaseID:SPBC31F10.09c Length:144 Species:Schizosaccharomyces pombe


Alignment Length:122 Identity:27/122 - (22%)
Similarity:64/122 - (52%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAPLENLETQLEMFIENVRQIRIIV---SDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVY 62
            |:..:::|.::||...:....:.:||   .|..|  .:.:.:.:::|:..|:.:..:..:|.:: 
pombe     7 MTDEMKSLASRLEDTTQAFYDLALIVYNLEDTTP--SDAIPESLDTLIRDLKSLPDISRKVNNL- 68

  Fly    63 VPFEVFFDYIDQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFP 119
            :|.:| .:||:|.:||.:|.:...|.....|:.|.||:..::.|:.....|:.:.:|
pombe    69 IPQDV-LEYIEQGRNPDVYARQFSELVQKDNQYVNGKLYAIEGFQKAFAEEIKQAYP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 25/114 (22%)
nut2NP_596571.2 Med10 17..132 CDD:313044 25/112 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3046
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004338
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103658
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R703
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.