DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and SPCC736.07c

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_587778.1 Gene:SPCC736.07c / 2538840 PomBaseID:SPCC736.07c Length:699 Species:Schizosaccharomyces pombe


Alignment Length:88 Identity:21/88 - (23%)
Similarity:32/88 - (36%) Gaps:24/88 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPFEV----------------FFDYIDQDKNPQL 80
            ||||||..   ....||..::.:.:.:|::....|:                |...:....:||.
pombe   385 QGQNVLEA---VQYDGLDSLEDMEALIQEMEEEGELDDNSESEEDEHGMTIGFSKELKAPPDPQY 446

  Fly    81 YTKDCVEKALAKNEEVKGKIEGL 103
            :|    ||..| ...|.|..|.|
pombe   447 FT----EKTGA-TTYVNGNDESL 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 21/88 (24%)
SPCC736.07cNP_587778.1 DUF3835 611..690 CDD:289679
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.