DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED10 and mdt-10

DIOPT Version :9

Sequence 1:NP_001261931.1 Gene:MED10 / 39777 FlyBaseID:FBgn0036581 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_495650.2 Gene:mdt-10 / 188311 WormBaseID:WBGene00007014 Length:183 Species:Caenorhabditis elegans


Alignment Length:124 Identity:54/124 - (43%)
Similarity:80/124 - (64%) Gaps:1/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LETQLEMFIENVRQIRIIVSDFQPQGQNVLNQKINSLVTGLQEIDKLRSQVQDVYVPFEVFFDYI 72
            ||.:||.|.||.|.|..:.|:||.:.|:.||.:|.:||.|||::|:::....|..||.:: ..|:
 Worm    57 LEKKLEEFQENARFIGDLASNFQTKYQDALNGRIYTLVRGLQDLDRMKGTFSDKKVPLDL-LPYL 120

  Fly    73 DQDKNPQLYTKDCVEKALAKNEEVKGKIEGLKKFKTNLLLELYKTFPNEMNNYRAYRKD 131
            |..|||.||:|.|:||.|.||:.|.||||..|||:.:|:.|..:..|:.:..||:.|:|
 Worm   121 DDGKNPCLYSKHCMEKTLEKNKAVNGKIEIYKKFRAHLMKEFSEEMPDLVMYYRSIRED 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED10NP_001261931.1 Med10 9..127 CDD:401627 50/117 (43%)
mdt-10NP_495650.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156689
Domainoid 1 1.000 94 1.000 Domainoid score I4741
eggNOG 1 0.900 - - E1_KOG3046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44533
Inparanoid 1 1.050 102 1.000 Inparanoid score I3558
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52837
OrthoDB 1 1.010 - - D1403581at2759
OrthoFinder 1 1.000 - - FOG0004338
OrthoInspector 1 1.000 - - oto19007
orthoMCL 1 0.900 - - OOG6_103658
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R703
SonicParanoid 1 1.000 - - X5428
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.