DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDCD-5 and SDD2

DIOPT Version :9

Sequence 1:NP_648848.1 Gene:PDCD-5 / 39776 FlyBaseID:FBgn0036580 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_013790.1 Gene:SDD2 / 855096 SGDID:S000004678 Length:145 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:34/139 - (24%)
Similarity:67/139 - (48%) Gaps:12/139 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DSDLDALRAQRMSQMQSQFGGGNDAEKQQAQQEQMRAQEEMKHSILSQVLDQQARARLNTLKVSK 67
            |.:|.|:|..|::|:::..||.| .::................:.::..|:.||..||:.:.:.:
Yeast     2 DPELQAIREARLAQLKNNSGGTN-GDRNSGANNGGGENSAPVGAAIANFLEPQALERLSRVALVR 65

  Fly    68 PEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESV-NAQMPQSKSSVKYDRRRAAID------- 124
            .::||..|..:.::.....|..|:.:|:.||||..: ..|..|:.|.:.::|:..:.|       
Yeast    66 RDRAQAVETYLKKLIATNNVTHKITEAEIVSILNGIAKQQNSQNNSKIIFERKDFSEDLNSFDKQ 130

  Fly   125 ---SDDDED 130
               :|||||
Yeast   131 NAKNDDDED 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDCD-5NP_648848.1 dsDNA_bind 9..104 CDD:280208 21/95 (22%)
SDD2NP_013790.1 PDCD5 1..118 CDD:225029 27/116 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344485
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2118
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I1853
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53907
OrthoFinder 1 1.000 - - FOG0004369
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101501
Panther 1 1.100 - - LDO PTHR10840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1824
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.790

Return to query results.
Submit another query.