DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDCD-5 and pdcd5

DIOPT Version :9

Sequence 1:NP_648848.1 Gene:PDCD-5 / 39776 FlyBaseID:FBgn0036580 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001017011.1 Gene:pdcd5 / 549765 XenbaseID:XB-GENE-1001834 Length:125 Species:Xenopus tropicalis


Alignment Length:130 Identity:61/130 - (46%)
Similarity:96/130 - (73%) Gaps:5/130 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSDLDALRAQRMSQMQSQFGGGNDAEKQQAQQEQMRAQEEMKHSILSQVLDQQARARLNTLKV 65
            |:|.:|:|:|.|||:::||:.|   ||...|:|||..:.:::|:::||:|||.|.||||||.|.:
 Frog     1 MADPELEAIRRQRMAELQSKHG---DAVNDQSQQEAKQREDDMRNNILAQVLSQAARARLNNLAL 62

  Fly    66 SKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSSVKYDRRRAAIDSDDDED 130
            .|||||:..||.:|:||:.||:.|||.:...:.|||.| :|..:.|::||::||: .:|||:|:|
 Frog    63 VKPEKAKAVENYLIQMARFGQLGGKLSEEGLIEILEKV-SQQTEKKTTVKFNRRK-VMDSDEDDD 125

  Fly   131  130
             Frog   126  125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDCD-5NP_648848.1 dsDNA_bind 9..104 CDD:280208 45/94 (48%)
pdcd5NP_001017011.1 dsDNA_bind 9..114 CDD:376701 50/108 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7000
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10506
Inparanoid 1 1.050 117 1.000 Inparanoid score I4652
OMA 1 1.010 - - QHG53907
OrthoDB 1 1.010 - - D1645187at2759
OrthoFinder 1 1.000 - - FOG0004369
OrthoInspector 1 1.000 - - oto104416
Panther 1 1.100 - - LDO PTHR10840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1824
SonicParanoid 1 1.000 - - X4748
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.