DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDCD-5 and Pdcd5

DIOPT Version :9

Sequence 1:NP_648848.1 Gene:PDCD-5 / 39776 FlyBaseID:FBgn0036580 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001099717.1 Gene:Pdcd5 / 292814 RGDID:1310561 Length:125 Species:Rattus norvegicus


Alignment Length:131 Identity:61/131 - (46%)
Similarity:95/131 - (72%) Gaps:6/131 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDSDLDALRAQRMSQMQSQFGGGNDAEKQQAQQEQMRAQEEMKHSILSQVLDQQARARLNTLKV 65
            |:|.:|:|||.||::::|::.|...||    ||||..:.:.||::|||:|||||.|||||:.|.:
  Rat     1 MADEELEALRKQRLAELQAKHGDPGDA----AQQEAKQREAEMRNSILAQVLDQSARARLSNLAL 61

  Fly    66 SKPEKAQMFENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSSVKYDRRRAAIDSDDDED 130
            .||||.:..||.:|:||:.||:.||:.:...:.|||.| :|..:.|::||::||: .:|||:|:|
  Rat    62 VKPEKTKAVENYLIQMARYGQLSGKVSEQGLIEILEKV-SQQTEKKTTVKFNRRK-VMDSDEDDD 124

  Fly   131 Y 131
            |
  Rat   125 Y 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDCD-5NP_648848.1 dsDNA_bind 9..104 CDD:280208 44/94 (47%)
Pdcd5NP_001099717.1 dsDNA_bind 9..114 CDD:396530 49/109 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344234
Domainoid 1 1.000 95 1.000 Domainoid score I7221
eggNOG 1 0.900 - - E1_COG2118
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10506
Inparanoid 1 1.050 116 1.000 Inparanoid score I4719
OMA 1 1.010 - - QHG53907
OrthoDB 1 1.010 - - D1645187at2759
OrthoFinder 1 1.000 - - FOG0004369
OrthoInspector 1 1.000 - - otm45804
orthoMCL 1 0.900 - - OOG6_101501
Panther 1 1.100 - - LDO PTHR10840
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4748
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.