DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PDCD-5 and D2005.3

DIOPT Version :9

Sequence 1:NP_648848.1 Gene:PDCD-5 / 39776 FlyBaseID:FBgn0036580 Length:133 Species:Drosophila melanogaster
Sequence 2:NP_001369982.1 Gene:D2005.3 / 183935 WormBaseID:WBGene00008398 Length:130 Species:Caenorhabditis elegans


Alignment Length:122 Identity:51/122 - (41%)
Similarity:76/122 - (62%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LRAQRMSQMQSQFGGGNDAEKQQAQQEQMRAQEEMKHSILSQVLDQQARARLNTLKVSKPEKAQM 73
            :.||..|.:.......::..:|||:.     ||..|:.::||:|||.|..||:.|.|:|||||||
 Worm    14 MEAQGASSIPQPSQDAHEKARQQAEN-----QETAKNGMISQILDQAAMQRLSNLAVAKPEKAQM 73

  Fly    74 FENMVIRMAQMGQVRGKLDDAQFVSILESVNAQMPQSKSSVKYDRRRAAIDSDDDED 130
            .|..:|.||:.||:.||:.|....:::|.|:|| .|..:|||:||||..:|||::.|
 Worm    74 VEAALINMARRGQLSGKMTDDGLKALMERVSAQ-TQKATSVKFDRRRNELDSDEELD 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PDCD-5NP_648848.1 dsDNA_bind 9..104 CDD:280208 36/94 (38%)
D2005.3NP_001369982.1 dsDNA_bind 24..118 CDD:396530 41/99 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161684
Domainoid 1 1.000 78 1.000 Domainoid score I5691
eggNOG 1 0.900 - - E1_COG2118
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10506
Inparanoid 1 1.050 89 1.000 Inparanoid score I3690
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53907
OrthoDB 1 1.010 - - D1645187at2759
OrthoFinder 1 1.000 - - FOG0004369
OrthoInspector 1 1.000 - - oto20400
orthoMCL 1 0.900 - - OOG6_101501
Panther 1 1.100 - - LDO PTHR10840
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1824
SonicParanoid 1 1.000 - - X4748
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.