DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and EUG1

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_010806.1 Gene:EUG1 / 852130 SGDID:S000002926 Length:517 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:73/339 - (21%)
Similarity:106/339 - (31%) Gaps:128/339 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEF 109
            ||.|:||||.:.:...|.....|..|...||.|.::||........:..:..|||:...|....|
Yeast    54 LVEFFAPWCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIF 118

  Fly   110 ---TYNGDRGRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAE 171
               .|.|.:..||:..|.:::                                            
Yeast   119 DGQVYRGVKITDEITQYMIQL-------------------------------------------- 139

  Fly   172 GYQEHGFFYATSEDIAAQHFDFEKLPAVI---------VYKE------EQHHFYP---------H 212
              .|....|..|||....:.:...||.||         .|:|      |.:.|..         .
Yeast   140 --YEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEVALDLAEDYVFLSLLDSEDKSLS 202

  Fly   213 GHLAHEMDP------------NEVNETVFQWVNV---ERFT-----LFPKVTRFNI--------- 248
            .||.:..:|            |.|..|  ||:.|   ..||     ||||....|:         
Yeast   203 IHLPNTTEPILFDGNVDSLVGNSVALT--QWLKVVILPYFTDIEPDLFPKYISSNLPLAYFFYTS 265

  Fly   249 HQLLK--TNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARY-HDKFQFGWIGEPSIA-H 309
            .:.|:  |:.:..|......::|.||.:...|         .|..|: :.:.||     |..| |
Yeast   266 EEELEDYTDLFTQLGKENRGQINFIALNSTMF---------PHHVRFLNMREQF-----PLFAIH 316

  Fly   310 SII------LDQLP 317
            ::|      |.|||
Yeast   317 NMINNLKYGLPQLP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 25/85 (29%)
ER_PDI_fam 28..>355 CDD:273457 73/339 (22%)
EUG1NP_010806.1 ER_PDI_fam 33..487 CDD:273457 73/339 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.