Sequence 1: | NP_648847.3 | Gene: | CG5027 / 39775 | FlyBaseID: | FBgn0036579 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_110437.2 | Gene: | TXNDC5 / 81567 | HGNCID: | 21073 | Length: | 432 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 56/195 - (28%) |
---|---|---|---|
Similarity: | 83/195 - (42%) | Gaps: | 39/195 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 SALLLTLGSTGLSSKVLELSDRFIDVRH--EGQWLVMFYAPWCGYCKKTEPIFALVAQAL-HATN 74
Fly 75 VRVGRLDCTKYPAAAKEFKVRGYPTIMFIK-GNMEFTYNGDRGRDELVDYALRMSGPPVQLVTRT 138
Fly 139 ESVDMLKGSHTIFFIFVGQQEGVV-WDTYYAAAEGYQEHGFFYATSE----DIAAQHFDFEKLPA 198
Fly 199 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5027 | NP_648847.3 | PDI_a_TMX3 | 27..128 | CDD:239298 | 33/104 (32%) |
ER_PDI_fam | 28..>355 | CDD:273457 | 50/180 (28%) | ||
TXNDC5 | NP_110437.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 40..63 | ||
PDI_a_ERp46 | 61..164 | CDD:239303 | |||
ER_PDI_fam | 66..432 | CDD:273457 | 56/195 (29%) | ||
PDI_a_ERp46 | 190..290 | CDD:239303 | 35/107 (33%) | ||
PDI_a_ERp46 | 323..424 | CDD:239303 | 7/25 (28%) | ||
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 | 429..432 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |