DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and tmx4

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001025330.1 Gene:tmx4 / 792311 ZFINID:ZDB-GENE-050706-155 Length:277 Species:Danio rerio


Alignment Length:184 Identity:47/184 - (25%)
Similarity:79/184 - (42%) Gaps:21/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MWIFGLISALLLTLGSTG----LSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEPIFALV 66
            :|    ||||.|||...|    .:|.|:.::|....:..:|:|::.||||||..|:..:..:..:
Zfish     9 LW----ISALFLTLAGRGDAQADASNVVTVADANWTLILQGEWMIKFYAPWCPACQHLQADWENL 69

  Fly    67 AQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPP 131
            .:...:..:.|||:|.|:.|..:..|.|...|||...|......|...|..:::..|.:......
Zfish    70 GRQSDSLGISVGRVDVTQQPGLSGRFLVTTLPTIFHAKNGDFRKYVSSRTIEDIQAYVVHRKWAT 134

  Fly   132 VQLVT--RTESVDMLKGSHTIFFIFVGQQEGVVW----DTYYAAAEGYQEHGFF 179
            |:.|.  ::.|..::.|...:|.:       .||    .||.....|....|.:
Zfish   135 VEPVPGWKSPSSLLMSGMAHLFRL-------SVWIRQIHTYLTNTLGIPSWGSY 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 26/100 (26%)
ER_PDI_fam 28..>355 CDD:273457 37/158 (23%)
tmx4NP_001025330.1 Thioredoxin_like 29..129 CDD:294274 27/99 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592009
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.