DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and txndc16

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001072460.2 Gene:txndc16 / 779915 XenbaseID:XB-GENE-989133 Length:808 Species:Xenopus tropicalis


Alignment Length:334 Identity:71/334 - (21%)
Similarity:129/334 - (38%) Gaps:45/334 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVMFYAPWCGYCKKTEPIFALVAQALHAT-NVRVGRLDCTKYPAAAKEFKVRGYPTI-MFIKGNM 107
            ::::||.|..........|..:|:....| ::.:.|::|..:|....|..|...|.: ::..|..
 Frog   402 MILYYASWEAVSLTLLQTFVHMAEKYKDTLDMILARVNCADWPNICSEQNVSNIPVVKIYQMGKE 466

  Fly   108 EFTYNGDRGRDELVDYA-LRMSGPPVQLVTRTESVDMLKGSHTIFF----------IFVGQQEGV 161
            ...|.|..|.:||..:: |.....|::|.:..|:...|.|....|.          ||....:.|
 Frog   467 PLEYTGMLGAEELFRFSMLAKVDCPLELFSYEEAEQFLSGKLNQFLLPYHNLSVLGIFTKNTKEV 531

  Fly   162 VWDTYYAAAE---GYQEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNE 223
              |:|:.|.:   |:...|.:|..:..|.::.:.... ||::..:.:.:..: ...|.|..:.:.
 Frog   532 --DSYFNAGKSLWGFASLGIYYEDNAMIMSKKYGITP-PALLFARHDTNQVH-SATLQHTAERDI 592

  Fly   224 VNETVFQWVNVERFTLFPKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRK 288
            :|.     |.:|....||::|..|........|.|   :|.....|...:.|....::|.|    
 Frog   593 INT-----VRMELLREFPEITMENFPTFFMQKKPL---LVLFSNCNPTQSDEKHILNLVRG---- 645

  Fly   289 HRARYHDKFQFGWIGEPSIAHSI--------ILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQA 345
               ||.|:|...|:...:....:        |:..||...||..:|..|....|.|.  .:|...
 Frog   646 ---RYLDQFLACWLNLKNTPVGVGILQRYFGIVPSLPQLVLIDFDSLGQVFSFPLDH--HLTDVN 705

  Fly   346 LHLFLESIR 354
            :..:||.|:
 Frog   706 ILYWLEMIK 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 19/85 (22%)
ER_PDI_fam 28..>355 CDD:273457 71/334 (21%)
txndc16NP_001072460.2 ER_PDI_fam 383..>716 CDD:273457 71/334 (21%)
PDI_a_family 386..482 CDD:239259 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.