DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Pdia6

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_082235.2 Gene:Pdia6 / 71853 MGIID:1919103 Length:440 Species:Mus musculus


Alignment Length:126 Identity:43/126 - (34%)
Similarity:66/126 - (52%) Gaps:10/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSTGLSSKVLELSDRFID---VRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHAT---NVRVG 78
            |.:.....|:||:|...|   :..|..|:|.|||||||:||..||.:|..|..:...   .|::.
Mouse   154 GDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLA 218

  Fly    79 RLDCTKYPAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRM---SGPPVQLV 135
            .:|.|.....|..:.::|:||| :|.||.....|:|.|.|.::|..||.:   :.||.:|:
Mouse   219 AVDATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 39/110 (35%)
ER_PDI_fam 28..>355 CDD:273457 42/118 (36%)
Pdia6NP_082235.2 PDI_a_P5 26..128 CDD:239299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..161 1/6 (17%)
PDI_a_P5 161..266 CDD:239299 37/104 (36%)
P5_C 275..404 CDD:239281 2/5 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..440
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 437..440
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.