DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Erp27

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_081259.1 Gene:Erp27 / 69187 MGIID:1916437 Length:272 Species:Mus musculus


Alignment Length:273 Identity:56/273 - (20%)
Similarity:99/273 - (36%) Gaps:84/273 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 ATSEDIAAQH------FDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTL 239
            ||.|.|||..      |...::|.|.|::.....|            .:|:..:.....|     
Mouse    48 ATVELIAAAEVAVIGFFQDLEIPIVSVFRSMARQF------------QDVSFGISNHSEV----- 95

  Fly   240 FPKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIGE 304
               :|.:|:    .:|...:..:|.:.:|:      |...| :|.:.....:|:.......|:.|
Mouse    96 ---LTHYNV----TSNSICLFRLVDDQQLH------LNAED-IENLDAAKLSRFIHVNNLHWVTE 146

  Fly   305 --PSIAHSIILDQLPTPHLIAINSSTQHHFIPE-DDPMQMTPQALHLF--------LESIRNESA 358
              |.||..:....:.| ||:.:...|.    || ::.|:...:|..||        ::|.:.|:.
Mouse   147 YSPMIAAGLFNTMVQT-HLLLMMKKTS----PEYEESMRRYREAAKLFQGQILFVLVDSGKRENG 206

  Fly   359 IAYGGDTYFVRLNR------ALFEVRRALRDMWLGNPVL-TTV--IFGLPLGFLSLIMYSIFCGD 414
            ...   :|| :|..      |::|   ::.|.|...|:. .||  :.|...|||..::       
Mouse   207 KVM---SYF-KLKESQLPALAIYE---SVDDKWDTLPIAEVTVEKVRGFCEGFLKGLL------- 257

  Fly   415 CLVTEEDPDEDHE 427
                    ..|||
Mouse   258 --------QRDHE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298
ER_PDI_fam 28..>355 CDD:273457 38/190 (20%)
Erp27NP_081259.1 Thioredoxin_6 64..250 CDD:372755 44/228 (19%)
PDIA3-binding site. /evidence=ECO:0000250|UniProtKB:Q96DN0 230..233 1/2 (50%)
Prevents secretion from ER. /evidence=ECO:0000250|UniProtKB:Q96DN0 269..272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.