DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and pdia5

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001107048.1 Gene:pdia5 / 556162 ZFINID:ZDB-GENE-030521-5 Length:528 Species:Danio rerio


Alignment Length:112 Identity:37/112 - (33%)
Similarity:59/112 - (52%) Gaps:6/112 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SKVLELSDRFID--VRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGRL---DCTKY 85
            |.|..|:|...|  :......|:||||||||:|||.:|.:...|:.|:......|.|   |.|.:
Zfish   284 SAVFHLTDDSFDSFLEEHPSALIMFYAPWCGHCKKMKPEYDDAAETLNKDPNSPGVLAAVDTTIH 348

  Fly    86 PAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRMSGPP 131
            .:..:.||:.|:||: .|.||..::|....|.:|:::::......||
Zfish   349 KSTGERFKISGFPTVKYFEKGEEKYTLPHLRSKDKIIEWLKNPQAPP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 34/106 (32%)
ER_PDI_fam 28..>355 CDD:273457 36/110 (33%)
pdia5NP_001107048.1 PDI_b_PDIR_N 36..147 CDD:239365
PDI_a_PDIR 160..264 CDD:239295
ER_PDI_fam 181..512 CDD:273457 37/112 (33%)
PDI_a_PDIR 285..388 CDD:239295 34/102 (33%)
PDI_a_PDIR 407..510 CDD:239295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.