DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and DNAJC10

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_061854.1 Gene:DNAJC10 / 54431 HGNCID:24637 Length:793 Species:Homo sapiens


Alignment Length:142 Identity:38/142 - (26%)
Similarity:58/142 - (40%) Gaps:37/142 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 MWIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEPIFALVAQAL 70
            :|..|.:..:...|.....|.|||:         .:..|::.|||||||.|:...|.|.|:|:.:
Human   662 IWGLGFLPQVSTDLTPQTFSEKVLQ---------GKNHWVIDFYAPWCGPCQNFAPEFELLARMI 717

  Fly    71 HATNVRVGRLDCTKYPAAAKEFKVRGYPTIMF--------------------------IKGNMEF 109
            .. .|:.|::||..|....::..:|.|||:.|                          |...:|.
Human   718 KG-KVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLET 781

  Fly   110 TYN-GDRGRDEL 120
            ..| |.|.:|||
Human   782 LRNQGKRNKDEL 793

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 34/121 (28%)
ER_PDI_fam 28..>355 CDD:273457 33/120 (28%)
DNAJC10NP_061854.1 DnaJ 34..>132 CDD:223560
PDI_a_ERdj5_N 129..229 CDD:239301
Trxb 1 235..350
Trxb 2 348..463
PDI_a_ERdj5_C 453..550 CDD:239302