DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and TXNDC11

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_011520817.1 Gene:TXNDC11 / 51061 HGNCID:28030 Length:998 Species:Homo sapiens


Alignment Length:335 Identity:74/335 - (22%)
Similarity:116/335 - (34%) Gaps:84/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLTLGSTGLSSK--VLEL-SDRFIDVRHEGQ-WLVMFYAPWCGYCKKTEPIFALVAQALHATNVR 76
            |:..||....|:  :.|: :|.|.:|..:.| .|:::||||||:|.....||..:|:.|......
Human   691 LIGSGSAQFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHIFIQLARNLPMDTFT 755

  Fly    77 VGRLDCTKYPAAAKEFKVRGYPTIMFIKGN---MEFTYNGD--RGRDELVDYALRMSGP--PVQL 134
            |.|:|.::.. ...||.|...||::|...|   :...|..|  .....|:.:.|..|.|  ..|.
Human   756 VARIDVSQND-LPWEFMVDRLPTVLFFPCNRKDLSVKYPEDVPITLPNLLRFILHHSDPASSPQN 819

  Fly   135 VTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQHFDFEKLPAV 199
            |..:.:.:.|            |.|.|:            :.|.......:|.....:...|...
Human   820 VANSPTKECL------------QSEAVL------------QRGHISHLEREIQKLRAEISSLQRA 860

  Fly   200 IVYKE--------------------EQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLFPKVT 244
            .|..|                    |:.|...|.|       :|..:.:::....|...|..|:.
Human   861 QVQVESQLSSARRDEHRLRQQQRALEEQHSLLHAH-------SEQLQALYEQKTRELQELARKLQ 918

  Fly   245 RF--NIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIGEPSI 307
            ..  ....||..|.:|.:.|...::       :||.||..|.:..:...  |.|..     |||.
Human   919 ELADASENLLTENTWLKILVATMER-------KLEGRDGAESLAAQREV--HPKQP-----EPSA 969

  Fly   308 AHSIILDQLP 317
            .     .|||
Human   970 T-----PQLP 974

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 31/109 (28%)
ER_PDI_fam 28..>355 CDD:273457 70/321 (22%)
TXNDC11XP_011520817.1 PDI_a_EFP1_N 97..209 CDD:239304
PDI_a_PDI_a'_C 705..807 CDD:239293 30/102 (29%)
RILP-like <843..928 CDD:304877 12/91 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.