DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and tmx4

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001034826.1 Gene:tmx4 / 496882 XenbaseID:XB-GENE-992676 Length:366 Species:Xenopus tropicalis


Alignment Length:138 Identity:38/138 - (27%)
Similarity:65/138 - (47%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKG 105
            ||:|::.||||||..|::.:..:...|:..||..|:||::|.|:.|..:..|.|...|||...|.
 Frog    60 EGEWMIKFYAPWCPACQQIQSAWESFAERSHALGVKVGKVDVTEEPGLSGRFFVTTLPTIFHAKD 124

  Fly   106 NMEFTYNGDRGRDELVDYALRMSGPPVQLVT--RTESVDMLKGSHTIFFI----------FVGQQ 158
            .:...|:|.|..::|..:........::.|.  |:.|..::.|..::|.:          |.|..
 Frog   125 GVFRRYHGSRMVEDLQTFISEKKWEVIEPVAGWRSPSSILMSGMASLFQLSGWMRQLHNYFTGPL 189

  Fly   159 EGVVWDTY 166
            ....|.:|
 Frog   190 GIPAWGSY 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 29/86 (34%)
ER_PDI_fam 28..>355 CDD:273457 38/138 (28%)
tmx4NP_001034826.1 PDI_a_TMX 45..145 CDD:239292 29/84 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.