DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and pdia8

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001003517.1 Gene:pdia8 / 445123 ZFINID:ZDB-GENE-040801-20 Length:493 Species:Danio rerio


Alignment Length:201 Identity:65/201 - (32%)
Similarity:94/201 - (46%) Gaps:42/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NSMWIFGLISALLLTLGSTGLS-SKVLELSDRFIDV---RHEGQWLVMFYAPWCGYCKKTEPIFA 64
            :.|.:.||:..|:.:|.|:... |.||:|:|...|.   .|| ..||.|||||||:|||..|.|.
Zfish     2 DEMILRGLLCILVCSLSSSAREHSDVLKLTDADFDYLAPEHE-TLLVKFYAPWCGHCKKLAPEFE 65

  Fly    65 LVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRMS 128
            ..|..|..| |.:.::|||......|.:.|.||||: :|..|....:|:|.|..|.:|||..:.:
Zfish    66 SAASRLKGT-VTLAKVDCTANTEICKHYGVNGYPTLKIFRNGQESSSYDGPRSADGIVDYMKKQA 129

  Fly   129 GPP---------------------VQLVTRTES---VDMLKG----------SHTIFFIFVGQQE 159
            ||.                     |.|.:.|:|   .:.|||          :||. .:.:||:.
Zfish   130 GPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFRFAHTT-DLQLGQKY 193

  Fly   160 GVVWDT 165
            ||..::
Zfish   194 GVTHES 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 43/104 (41%)
ER_PDI_fam 28..>355 CDD:273457 58/176 (33%)
pdia8NP_001003517.1 ER_PDI_fam 25..484 CDD:273457 59/178 (33%)
pdi_dom 30..129 CDD:273454 41/100 (41%)
PDI_b_ERp57 132..236 CDD:239367 13/69 (19%)
PDI_b'_ERp72_ERp57 240..353 CDD:239371
PDI_a_PDI_a'_C 373..476 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592008
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.