Sequence 1: | NP_648847.3 | Gene: | CG5027 / 39775 | FlyBaseID: | FBgn0036579 | Length: | 430 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003517.1 | Gene: | pdia8 / 445123 | ZFINID: | ZDB-GENE-040801-20 | Length: | 493 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 65/201 - (32%) |
---|---|---|---|
Similarity: | 94/201 - (46%) | Gaps: | 42/201 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 NSMWIFGLISALLLTLGSTGLS-SKVLELSDRFIDV---RHEGQWLVMFYAPWCGYCKKTEPIFA 64
Fly 65 LVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRMS 128
Fly 129 GPP---------------------VQLVTRTES---VDMLKG----------SHTIFFIFVGQQE 159
Fly 160 GVVWDT 165 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5027 | NP_648847.3 | PDI_a_TMX3 | 27..128 | CDD:239298 | 43/104 (41%) |
ER_PDI_fam | 28..>355 | CDD:273457 | 58/176 (33%) | ||
pdia8 | NP_001003517.1 | ER_PDI_fam | 25..484 | CDD:273457 | 59/178 (33%) |
pdi_dom | 30..129 | CDD:273454 | 41/100 (41%) | ||
PDI_b_ERp57 | 132..236 | CDD:239367 | 13/69 (19%) | ||
PDI_b'_ERp72_ERp57 | 240..353 | CDD:239371 | |||
PDI_a_PDI_a'_C | 373..476 | CDD:239293 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170592008 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |