DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and p4hb

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_998529.3 Gene:p4hb / 406673 ZFINID:ZDB-GENE-080610-1 Length:509 Species:Danio rerio


Alignment Length:405 Identity:93/405 - (22%)
Similarity:166/405 - (40%) Gaps:83/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVMFYAPWCGYCKKTEPIFALVAQALHA--TNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNM 107
            ||.|||||||:||...|.::..|..|.|  :::|:.::|.|:....|:||.|||||||.|.||..
Zfish    43 LVEFYAPWCGHCKALAPEYSKAAGMLKAEGSDIRLAKVDATEESELAQEFGVRGYPTIKFFKGGE 107

  Fly   108 EFT---YNGDRGRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTI----FFIFVGQQEGVVWDT 165
            :..   |:..|..:::|.:..:.:||....:......:.:...:.:    ||..|..::.   ..
Zfish   108 KGNPKEYSAGRQAEDIVSWLKKRTGPAATTLNDVMQAESIIADNEVAVIGFFKDVESEDS---KA 169

  Fly   166 YYAAAEGYQEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDPNEVNETVFQ 230
            :...||...:.. |..||:|.....|:..| .:|:::|:     :..|.  :..|.....|::..
Zfish   170 FIKTAEAVDDIP-FGITSDDSVFAKFEVAK-DSVVLFKK-----FDEGR--NTFDGEVSKESLLN 225

  Fly   231 WVNVERFTLF--------PKVTRFNI--HQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGV 285
            ::...:..|.        ||:...:|  |.|:...|   .|...:||::|       |:...|| 
Zfish   226 FIKANQLPLVIEFTEQTAPKIFGGDIKSHILMFVPK---AAKDFQDKMDQ-------FKKAAEG- 279

  Fly   286 IRKHRARYHDKFQFGWIGEPSIAHSIIL-------DQLPTPHLIAINSSTQHHFIPEDDPMQMTP 343
                   :..|..|.:|......:..||       ::.|...||.:          |::..:..|
Zfish   280 -------FKGKILFIFIDSDVDDNQRILEFFGLKKEECPVIRLITL----------EEEMTKYKP 327

  Fly   344 QALHLFLESIRNESAIAYGGDTYFVRLNRALFEVRRALRDMWLGNPVLTTVIFGL--------PL 400
            ::..:..|:|     |::  .|.||........:.:.:.:.|..|||  .|:.|.        |.
Zfish   328 ESSEITAENI-----ISF--CTSFVEGTLKPHLMSQDIPEDWDKNPV--KVLVGKNFEEVAFNPA 383

  Fly   401 GFLSLIMYSIFCGDC 415
            ..:.:..|:.:||.|
Zfish   384 NNVFVEFYAPWCGHC 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 34/87 (39%)
ER_PDI_fam 28..>355 CDD:273457 78/335 (23%)
p4hbNP_998529.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591987
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.