DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and txndc5

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_989186.1 Gene:txndc5 / 394794 XenbaseID:XB-GENE-490945 Length:405 Species:Xenopus tropicalis


Alignment Length:196 Identity:49/196 - (25%)
Similarity:83/196 - (42%) Gaps:39/196 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SKVLELSDRFIDV------RH--EGQWLVMFYAPWCGYCKKTEPIFALVAQALHATN-VRVGRLD 81
            :||.||.....::      .|  ||...:.|:|||||:||...|.:..:|.....:| :::.::|
 Frog   155 AKVPELKQGLYELTAANFKEHIAEGNHFIKFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVD 219

  Fly    82 CTKYPAAAKEFKVRGYPTIM-FIKGNMEFTYNGDRGRDELVDYALRMSGP--------------- 130
            ||::.....:.:||||||:: |..|.....|.|.|..|.|.:||.....|               
 Frog   220 CTQHNGLCSDNQVRGYPTLLWFRNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDATP 284

  Fly   131 -----PVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQH 190
                 ||.:.::..|:.......|:       ..||.:..:||...|:.::  .....||::.:.
 Frog   285 PQVEKPVAVESKVLSLSESNFDQTV-------ATGVSFIKFYAPWCGHCKN--LVPIWEDLSKKE 340

  Fly   191 F 191
            |
 Frog   341 F 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 36/110 (33%)
ER_PDI_fam 28..>355 CDD:273457 48/194 (25%)
txndc5NP_989186.1 PDI_a_ERp46 36..134 CDD:239303
PDI_a_ERp46 163..262 CDD:239303 30/98 (31%)
PDI_a_ERp46 296..397 CDD:239303 10/55 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.