DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Pdia5

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001014147.1 Gene:Pdia5 / 360722 RGDID:1359236 Length:517 Species:Rattus norvegicus


Alignment Length:231 Identity:56/231 - (24%)
Similarity:92/231 - (39%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VLELSDRFID--VRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGRL---DCTKYPA 87
            |..|:|...|  |:.....||||:|||||:|||.:|.|...|:.||......|.|   |.|...|
  Rat   276 VYHLTDEDFDQFVKEHSSVLVMFHAPWCGHCKKMKPEFESAAEVLHGDAESSGVLAAVDATINEA 340

  Fly    88 AAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPP-------------VQLVTRTE 139
            .|:.|.:..:||:.:.|...:......|.:.:.:::......||             :.||....
  Rat   341 LAERFHISAFPTLKYFKNGEQQAVPALRTKKKFIEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNF 405

  Fly   140 SVDMLKGSHTIFFIFVGQQEGVVW--------DTYYAAAEGYQEHGFFYATSED-IAAQHFDFEK 195
            ...:.|..||:...:      ..|        ..:.|.|:.:::.......:.| :..::.|..:
  Rat   406 RETLKKKKHTLVMFY------APWCPHCKKVIPHFTATADAFKDDRKIACAAVDCVKDKNQDLCQ 464

  Fly   196 LPAVIVYKEEQHHFYPHGHLA--HEMDPNEVNETVF 229
            ..:|..|  ...|:|.:|.|.  :|.|..|:..|.|
  Rat   465 QESVKAY--PTFHYYHYGKLVEKYESDRTELGFTSF 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 33/104 (32%)
ER_PDI_fam 28..>355 CDD:273457 56/231 (24%)
Pdia5NP_001014147.1 PDI_b_PDIR_N 26..137 CDD:239365
PDI_a_PDIR 150..254 CDD:239295
ER_PDI_fam 166..501 CDD:273457 56/231 (24%)
PDI_a_PDIR 275..377 CDD:239295 33/100 (33%)
PDI_a_PDIR 396..499 CDD:239295 21/111 (19%)
Prevents secretion from ER. /evidence=ECO:0000255 514..517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.