DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and CaBP1

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:262 Identity:69/262 - (26%)
Similarity:103/262 - (39%) Gaps:82/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSTGLSS--KVLELSDRFID---VRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGR 79
            |.:|.||  .|:||::...|   :..:..|||.|:|||||:||...|.:|..|:.|.. .|::|.
  Fly   148 GGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELKG-KVKLGA 211

  Fly    80 LDCTKYPAAAKEFKVRGYPTIMFIKGNMEFT-----YNGDRGRDELVDYA--------------- 124
            ||.|.:.:.|.|:.|||||||.|.....:..     |:|.|...::|.:|               
  Fly   212 LDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIE 276

  Fly   125 --------LRMSGPPVQLVT------------RTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAA 169
                    ....|.|:.:|:            |.:.:|.|:   |:...|..:|.|..|      
  Fly   277 IINESTFETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLR---TLGEKFKQKQWGWAW------ 332

  Fly   170 AEGYQEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHF--------------------YPHGH 214
            |||.|:    .|..|.:....|.:   ||:.|...::..|                    |..||
  Fly   333 AEGGQQ----LALEESLEVGGFGY---PAMAVVNFKKMKFSVLKGSFSKDGINEFLRDISYGRGH 390

  Fly   215 LA 216
            .|
  Fly   391 TA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 39/131 (30%)
ER_PDI_fam 28..>355 CDD:273457 65/252 (26%)
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 38/105 (36%)
Thioredoxin_6 190..383 CDD:290560 47/209 (22%)
P5_C 271..400 CDD:239281 26/138 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463734
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.