DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and CG9302

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster


Alignment Length:122 Identity:48/122 - (39%)
Similarity:67/122 - (54%) Gaps:14/122 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SSKVLELSDRFID--VRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVG--RLDCTKY 85
            |.:||.|.|....  ::.:...||||||||||:||.|:|.|...|.||. .:.|:.  .:||||.
  Fly   395 SKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAATALQ-DDPRIAFVAIDCTKL 458

  Fly    86 PAAAKEFKVRGYPTIM---FIKGNMEFTYNGDRGRDELVDYALRMSGPPVQLVTRTE 139
            .|...::.|||||||:   ::|..::  |||.|...:.:.|   |:.||.. ..|||
  Fly   459 AALCAKYNVRGYPTILYFSYLKTKLD--YNGGRTSKDFIAY---MNNPPTS-ADRTE 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 41/107 (38%)
ER_PDI_fam 28..>355 CDD:273457 47/119 (39%)
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 43/110 (39%)
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295 41/106 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463740
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.