DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and CG9911

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_573111.1 Gene:CG9911 / 32588 FlyBaseID:FBgn0030734 Length:412 Species:Drosophila melanogaster


Alignment Length:359 Identity:81/359 - (22%)
Similarity:137/359 - (38%) Gaps:58/359 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IDVRHEGQWLVM--FYAPWCGYCKKTEPIFALVAQAL-----HATNVRVGRLDCTKYPAAAKEFK 93
            ||:......||.  |||.||.:.....||||..|..:     .|..|.:|::||.|..|.|..|.
  Fly    43 IDMTLASNELVFLNFYAEWCRFSNILAPIFAEAADKIKEEFPEAGKVVLGKVDCDKETAIASRFH 107

  Fly    94 VRGYPTIMFIKGNM--EFTYNGDRGRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFIFVG 156
            :..|||:..::...  :..|.|.|..:..:::..:....|:|.....:.::.|.....:...:..
  Fly   108 INKYPTLKIVRNGQLSKREYRGQRSAEAFLEFVKKQLEDPIQEFKSLKDLENLDSKKRLILGYFD 172

  Fly   157 QQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEMDP 221
            :::...:|.:...|...:|...|:....| |||.......|.::        |.|...|:||.|.
  Fly   173 RRDQPEYDIFRKVATNLKEDCQFHVGFGD-AAQAMHPPGTPIIV--------FRPDVALSHENDE 228

  Fly   222 NEVN-----ETVFQWVNVERFTLFPKVTRFNIHQLLKTN-KYLVLAVVQEDKLNQIATHELEFRD 280
            ....     :.:..||..:...|..::|..|..:|.:.. .:|:|.....|. |.|.    :::.
  Fly   229 TYTGSLQNFDELKIWVQEKCVPLVREITFENAEELTEEGLPFLILFHHPTDH-NSIK----DYKS 288

  Fly   281 MVEGVIRKHRARYHDKFQFGWIGEPS--IAHSI-----ILDQLPTPHLIAINSSTQHHFIPEDDP 338
            ::|      |....:|....::....  .||.:     ..|.||   ||||:|....:..|....
  Fly   289 IIE------RQLLDEKQNVNFLTADGKRFAHPLHHLGKSEDDLP---LIAIDSFKHMYLFPHFSD 344

  Fly   339 MQMTPQALHLFLESIRNESAIAYGGDTYFVRLNR 372
            | .:|..|..||:            |.|..:|:|
  Fly   345 M-YSPGKLKQFLQ------------DLYSGKLHR 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 29/100 (29%)
ER_PDI_fam 28..>355 CDD:273457 77/340 (23%)
CG9911NP_573111.1 PDI_a_ERp44 33..140 CDD:239294 29/96 (30%)
PDI_b_ERp44 148..241 CDD:239368 17/101 (17%)
Thioredoxin_6 171..357 CDD:290560 45/221 (20%)
PDI_b'_ERp44 252..362 CDD:239370 29/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463728
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.