DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and tmx1

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001108605.1 Gene:tmx1 / 323607 ZFINID:ZDB-GENE-030131-2327 Length:284 Species:Danio rerio


Alignment Length:148 Identity:37/148 - (25%)
Similarity:67/148 - (45%) Gaps:24/148 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGN 106
            |:|::.|:||||..|::.||::...|.......|.:.::|.|::|..:..|.:...|||...|..
Zfish    52 GEWMIEFFAPWCPACQQLEPVWTEFAGWGDDLGVNIAKVDVTEHPGLSGRFIIMALPTIYHCKDG 116

  Fly   107 MEFTYNGDRGRDELVDYALRMS-----------GPPVQLVTRTESVDMLKGSHTIFFI-----FV 155
            :...|.|||.:::.:.:.....           ||...|:....::..|.     .||     ::
Zfish   117 VFRRYQGDRSKEDFLSFIEEKKWQSIEPVSSWFGPSSFLMNIMSALFKLS-----VFIRHCHNYL 176

  Fly   156 GQQEGV-VWDTY--YAAA 170
            .:|.|. ||::|  :|.|
Zfish   177 TEQMGFSVWESYGIFACA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 24/85 (28%)
ER_PDI_fam 28..>355 CDD:273457 37/148 (25%)
tmx1NP_001108605.1 PDI_a_TMX 36..136 CDD:239292 24/83 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.