DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and prtp

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001188583.1 Gene:prtp / 32124 FlyBaseID:FBgn0030329 Length:416 Species:Drosophila melanogaster


Alignment Length:224 Identity:55/224 - (24%)
Similarity:92/224 - (41%) Gaps:45/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KVLELS-DRFIDVRHEGQWLVMFYAPWCGYCKKTEPIFA-LVAQALHATNVRVGRLDCTKYPAAA 89
            ||::|: |.|......|...|.|:||||.:|::..|.:. |..:.:....|.:.::|||::.:..
  Fly   167 KVVDLTEDTFAKHVSTGNHFVKFFAPWCSHCQRLAPTWEDLAKELIKEPTVTISKIDCTQFRSIC 231

  Fly    90 KEFKVRGYPTIMFIK-GNMEFTYNGDRGRDELVDYALRMSGPPVQLVTRTES------VDMLKGS 147
            ::|:|:||||:::|: |.....|:|.|....|..|..:|.|.|:: .|..|:      ::.:.|.
  Fly   232 QDFEVKGYPTLLWIEDGKKIEKYSGARDLSTLKTYVEKMVGVPLE-KTAGEAGDEKVVIEEVAGE 295

  Fly   148 HTIFFIFVGQQ------------EGVVWDTYYA----------------AAEGYQEHGFFYATSE 184
            .........||            |||.:..:||                |.|.:|..........
  Fly   296 EDAAKKLTPQQLTGEDEFDQAIAEGVAFIKFYAPWCGHCQKLQPTWEQLATETHQAQSSVKIAKV 360

  Fly   185 DIAAQH-------FDFEKLPAVIVYKEEQ 206
            |..|..       ...|..|.:.:||..|
  Fly   361 DCTAPENKQVCIDQQVEGYPTLFLYKNGQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 32/103 (31%)
ER_PDI_fam 28..>355 CDD:273457 54/223 (24%)
prtpNP_001188583.1 PDI_a_ERp46 38..140 CDD:239303
ER_PDI_fam 39..409 CDD:273457 55/224 (25%)
PDI_a_ERp46 167..267 CDD:239303 31/99 (31%)
PDI_a_ERp46 303..407 CDD:239303 17/87 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463741
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.