DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Pdia3

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_059015.2 Gene:Pdia3 / 29468 RGDID:68430 Length:510 Species:Rattus norvegicus


Alignment Length:380 Identity:83/380 - (21%)
Similarity:155/380 - (40%) Gaps:74/380 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LISALLLTLGSTGLSSKVLELSD-----RFIDVRHEGQWLVMFYAPWCGYCKKTEPIFALVAQAL 70
            |:::.||.......:|.||||:|     |..|....|..||.|:|||||:||:..|.:...|..|
  Rat    15 LLASALLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRL 79

  Fly    71 HATNVRVGRLDCTKYPAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQL 134
            ... |.:.::|||.......::.|.||||: :|..|.....|:|.|..|.:|.:..:.:| |..:
  Rat    80 KGI-VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAG-PASV 142

  Fly   135 VTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQHFDFEKLPAV 199
            ..|||..         |..|:..::..|             .|||.....|   .|.:|.|..:.
  Rat   143 PLRTEDE---------FKKFISDKDASV-------------VGFFRDLFSD---GHSEFLKAASN 182

  Fly   200 IVYKEEQHHFYPHGH---LAHEMDPNEVNETVFQWVNV-----ERFTLF--PKVTRFNIHQLLKT 254
            :    ..::.:.|.:   |..|.|.|....|:|:.:::     ::...:  .|:|...|.:.::.
  Rat   183 L----RDNYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQE 243

  Fly   255 NKYLVLAVVQEDKLNQI-------ATHELEFRDMVEG---------VIRKHRARYHDKFQFGWIG 303
            :.:.:...:.||..:.|       |.:::::....:|         ::.|.......|..|....
  Rat   244 SIFGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFAVAS 308

  Fly   304 EPSIAHSI-------ILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLE 351
            ..:.:|.:       ...::|   ::||.::....|:.::: .....:||..||:
  Rat   309 RKTFSHELSDFGLESTTGEIP---VVAIRTAKGEKFVMQEE-FSRDGKALERFLQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 37/106 (35%)
ER_PDI_fam 28..>355 CDD:273457 79/363 (22%)
Pdia3NP_059015.2 ER_PDI_fam 31..492 CDD:273457 79/364 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..510
Prevents secretion from ER 507..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.