DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Pdia6

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001004442.1 Gene:Pdia6 / 286906 RGDID:628688 Length:445 Species:Rattus norvegicus


Alignment Length:126 Identity:43/126 - (34%)
Similarity:66/126 - (52%) Gaps:10/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GSTGLSSKVLELSDRFID---VRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHAT---NVRVG 78
            |.:.....|:||:|...|   :..|..|:|.|||||||:||..||.:|..|..:...   .|::.
  Rat   159 GDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLA 223

  Fly    79 RLDCTKYPAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRM---SGPPVQLV 135
            .:|.|.....|..:.::|:||| :|.||.....|:|.|.|.::|..||.:   :.||.:|:
  Rat   224 AVDATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 39/110 (35%)
ER_PDI_fam 28..>355 CDD:273457 42/118 (36%)
Pdia6NP_001004442.1 PDI_a_P5 31..133 CDD:239299
PDI_a_P5 166..271 CDD:239299 37/104 (36%)
P5_C 280..409 CDD:239281 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.