DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and pdi2

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_595525.1 Gene:pdi2 / 2541041 PomBaseID:SPBC3D6.13c Length:726 Species:Schizosaccharomyces pombe


Alignment Length:328 Identity:63/328 - (19%)
Similarity:120/328 - (36%) Gaps:25/328 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TLGSTGLSSKVLELSDRFIDVR---HEGQWLVMFYAPWCGYCKKTEPIFALVAQALHATNVRVGR 79
            ::..|| :||.|.| |..||..   .|| |.:.||:..|..|......:..:|..:.. .:.|..
pombe   275 SINPTG-TSKALAL-DADIDAALTDKEG-WFIQFYSSECDDCDDVSTAWYAMANRMRG-KLNVAH 335

  Fly    80 LDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQLVTRTESVDML 144
            ::|.....|.|::.::.:||.:|.|......|.|.....:||.:|...:...::.|...::|:..
pombe   336 INCAVSKRACKQYSIQYFPTFLFFKEEAFVEYVGLPNEGDLVSFAEEAANFEIREVELLDTVNAE 400

  Fly   145 KGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEHGFFYATSEDIAAQHFDFEKLPAVIVYKEEQHHF 209
            |.....|..|.........:...........|...|.|:....|:.:.....|.:||.::....:
pombe   401 KNGDVFFLYFYDDDSAEYLNIIRKTGIQLLGHANLYLTTSQQIAKKYRVVSFPKLIVVRDGIASY 465

  Fly   210 YPHGHLAHEMDPNEVNETVFQWVNVERFTLFPKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATH 274
            ||    |.....|:....:..|:......:.|::...|..::......::.          :...
pombe   466 YP----AKMAQDNKDYRRILGWMKNNWLPVLPELRTSNSKEIFNDESVVLF----------LLNP 516

  Fly   275 ELEFRDMVEGVIRKHRARYHDK----FQFGWIGEPSIAHSIILDQLPTPHLIAINSSTQHHFIPE 335
            ||:..|..:...:|....:.|:    :|..|..|....:|::.:......|.||.::...|...:
pombe   517 ELDDFDETKRTAQKIATEFLDEEGRTYQSNWQKETDKKNSLVNEAEEKNDLEAIEAAKNFHVNGK 581

  Fly   336 DDP 338
            ..|
pombe   582 PSP 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 27/103 (26%)
ER_PDI_fam 28..>355 CDD:273457 59/318 (19%)
pdi2NP_595525.1 PDI_a_family 29..130 CDD:239259
PDI_a_family 288..380 CDD:239259 23/93 (25%)
Thioredoxin_6 412..624 CDD:290560 28/187 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46426
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.