DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Y73B6BL.12

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_500961.2 Gene:Y73B6BL.12 / 190648 WormBaseID:WBGene00022236 Length:136 Species:Caenorhabditis elegans


Alignment Length:110 Identity:34/110 - (30%)
Similarity:60/110 - (54%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFGLISALLLTLGSTGLSSKVLELSDRFIDVRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALH 71
            |::..:...:::||: ...:.||:.|:         .|:|.|:|||||:|.:..||:..:|:.| 
 Worm    11 WVYNFLPTEVVSLGN-DFHTTVLDSSE---------PWIVDFFAPWCGHCIQFAPIYDRIAKEL- 64

  Fly    72 ATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRG 116
            |..|...::||.::|...:..:||.||||....|...::..||:|
 Worm    65 AGKVNFAKIDCDQWPGVCQGAQVRAYPTIRLYTGKTGWSRQGDQG 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 31/90 (34%)
ER_PDI_fam 28..>355 CDD:273457 31/89 (35%)
Y73B6BL.12NP_500961.2 PDI_a_ERdj5_C 18..121 CDD:239302 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.