DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and P4hb

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_035162.1 Gene:P4hb / 18453 MGIID:97464 Length:509 Species:Mus musculus


Alignment Length:384 Identity:87/384 - (22%)
Similarity:158/384 - (41%) Gaps:77/384 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LISALLLTLG---STGLSSKVLELSDRFIDVRHEG---------QWLVMFYAPWCGYCKKTEPIF 63
            ::|..||.|.   :..:.:..||..|..:.::...         ..||.|||||||:||...|.:
Mouse     1 MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEY 65

  Fly    64 ALVAQALHA--TNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGD----------RG 116
            |..|..|.|  :.:|:.::|.|:....|:::.|||||||.|.|       |||          |.
Mouse    66 AKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFK-------NGDTASPKEYTAGRE 123

  Fly   117 RDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFI-FVGQQEGVVWDTYYAAAEGYQEHGFFY 180
            .|::|::..:.:||....::.|.:.:.|..|..:..| |....|......:..|||...:..|..
Mouse   124 ADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEAIDDIPFGI 188

  Fly   181 ATSEDIAAQHFDFEKLPAVIVYK---EEQHHFYPHGHLAHEMDPNEVNETVFQWVNVERFTLFPK 242
            .::..:.:: :..:| ..|:::|   |.:::|  .|.:        ..|.:..::...:..|..:
Mouse   189 TSNSGVFSK-YQLDK-DGVVLFKKFDEGRNNF--EGEI--------TKEKLLDFIKHNQLPLVIE 241

  Fly   243 VTRFNIHQL----LKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIG 303
            .|.....::    :||:..|.|.....|...::::    |:...||        :..|..|.:|.
Mouse   242 FTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSS----FKRAAEG--------FKGKILFIFID 294

  Fly   304 EPSIAHSIIL-------DQLPTPHLIAINSSTQHHFIPEDDPMQMTPQAL----HLFLE 351
            .....:..||       ::.|...||.:... ...:.||.|  ::|.:.:    |.|||
Mouse   295 SDHTDNQRILEFFGLKKEECPAVRLITLEEE-MTKYKPESD--ELTAEKITEFCHRFLE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 38/121 (31%)
ER_PDI_fam 28..>355 CDD:273457 83/364 (23%)
P4hbNP_035162.1 ER_PDI_fam 26..476 CDD:273457 81/359 (23%)
Thioredoxin_like 31..135 CDD:294274 35/110 (32%)
PDI_b_family 139..234 CDD:239279 17/106 (16%)
PDI_b'_family 246..349 CDD:239280 21/117 (18%)
PDI_a_PDI_a'_C 370..472 CDD:239293
Prevents secretion from ER 506..509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846779
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.