DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and C14B9.2

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_498775.2 Gene:C14B9.2 / 176147 WormBaseID:WBGene00015752 Length:618 Species:Caenorhabditis elegans


Alignment Length:299 Identity:73/299 - (24%)
Similarity:125/299 - (41%) Gaps:47/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVMFYAPWCGYCKKTEPIFALVAQALHA--TNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNM 107
            ||.|||||||:|||..|.:...||.|.|  :.|::|::|.|.......::.|.||||:..|:...
 Worm   168 LVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGR 232

  Fly   108 EFTYNGDRGRDELVDYALRMSGPPVQLVTRTESVDMLKGSHTIFFI-FVGQQEGVVWDTYYAAAE 171
            .|.|||.|....::.|....|.|..:.:.:.:.|:.......:..| |...::...::.:..:||
 Worm   233 RFDYNGPREAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTIIGFFATEDSTAFEAFSDSAE 297

  Fly   172 GYQEHGFFYATSEDIAAQHFDFEKLPA----VIVYKEEQHHFYPHGHLAH-EMDPNE-------- 223
            ..:|.......:.|.||    |:|..|    :|:       |||  .|.| :.:|..        
 Worm   298 MLREEFKTMGHTSDPAA----FKKWDAKPNDIII-------FYP--SLFHSKFEPKSRTYNKAAA 349

  Fly   224 VNETVFQWVNVERFTLFPKVTRFNIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRK 288
            .:|.:..:.......|..|:|:.|. ....|.|.||:.....|...|.......:|..|..:.:|
 Worm   350 TSEDLLAFFREHSAPLVGKMTKKNA-ATRYTKKPLVVVYYNADFSVQYREGSEYWRSKVLNIAQK 413

  Fly   289 HRARYHDKFQFG--------------WIGEPSIAHSIIL 313
            ::   .||::|.              .:|:..:.|::::
 Worm   414 YQ---KDKYKFAVADEEEFAKELEELGLGDSGLEHNVVV 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 33/84 (39%)
ER_PDI_fam 28..>355 CDD:273457 73/299 (24%)
C14B9.2NP_498775.2 pdi_dom 41..138 CDD:273454
ER_PDI_fam 147..616 CDD:273457 73/299 (24%)
pdi_dom 152..253 CDD:273454 33/84 (39%)
Thioredoxin_like 256..361 CDD:294274 20/117 (17%)
PDI_b'_ERp72_ERp57 366..476 CDD:239371 17/88 (19%)
PDI_a_PDI_a'_C 500..604 CDD:239293
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.