DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Pdia3

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_031978.2 Gene:Pdia3 / 14827 MGIID:95834 Length:505 Species:Mus musculus


Alignment Length:449 Identity:108/449 - (24%)
Similarity:177/449 - (39%) Gaps:104/449 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALLLTLGSTGLSSKVLELSD-----RFIDVRHEGQWLVMFYAPWCGYCKKTEPIFALVAQALHAT 73
            ||||.......:|.||||:|     |..|....|..||.|:|||||:||:..|.:...|..|...
Mouse    13 ALLLASARLAAASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI 77

  Fly    74 NVRVGRLDCTKYPAAAKEFKVRGYPTI-MFIKGNMEFTYNGDRGRDELVDYALRMSGPPVQLVTR 137
             |.:.::|||.......::.|.||||: :|..|.....|:|.|..|.:|.:..:.:| |..:..|
Mouse    78 -VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAG-PASVPLR 140

  Fly   138 TESVDMLKGSHTIFFIFVGQQE----GVVWDTYYAAAEGYQEHGFFYATS---EDIAAQHFDFEK 195
            ||..         |..|:..::    |...|.:   ::|:.|  |..|.|   ::....|.:.|.
Mouse   141 TEEE---------FKKFISDKDASVVGFFRDLF---SDGHSE--FLKAASNLRDNYRFAHTNIES 191

  Fly   196 LPAVIVYKEEQHH------FYPHGHLAHEMDPNEVNET--------VFQWVNVERFTLFPKVTRF 246
            |     .||...:      |.|. |||::.:...|..|        :.:::....|.|.|.:|..
Mouse   192 L-----VKEYDDNGEGITIFRPL-HLANKFEDKTVAYTEKKMTSGKIKKFIQDSIFGLCPHMTED 250

  Fly   247 NIHQLLKTNKYLVLAVVQEDKLNQIATHELEFRDMVEGVIRKHRARYHDKFQFGWIGEPSIAHSI 311
            |  :.|...|.|:.|....| ..:.|.....:|:.|..|.:|.....| |..|......:.:|.:
Mouse   251 N--KDLIQGKDLLTAYYDVD-YEKNAKGSNYWRNRVMMVAKKFLDAGH-KLNFAVASRKTFSHEL 311

  Fly   312 -------ILDQLPTPHLIAINSSTQHHFIPEDDPMQMTPQALHLFLESIRNESAIAYGGDTYFVR 369
                   ...::|   ::||.::....|:.:::                             |.|
Mouse   312 SDFGLESTTGEVP---VVAIRTAKGEKFVMQEE-----------------------------FSR 344

  Fly   370 LNRALFEVRRALRDMWLGNPVLTTVIFGLPL-----GFLSLIMYSIFCGDCLVTEEDPD 423
            ..:||   .:.|::.:.||  |...:...|:     |.:.:::...|  |.:|.|||.|
Mouse   345 DGKAL---EQFLQEYFDGN--LKRYLKSEPIPESNEGPVKVVVAENF--DDIVNEEDKD 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 37/106 (35%)
ER_PDI_fam 28..>355 CDD:273457 86/360 (24%)
Pdia3NP_031978.2 ER_PDI_fam 26..487 CDD:273457 103/436 (24%)
Thioredoxin 27..131 CDD:278513 37/104 (36%)
PDI_b_ERp57 135..240 CDD:239367 24/124 (19%)
PDI_b'_ERp72_ERp57 244..357 CDD:239371 26/151 (17%)
PDI_a_PDI_a'_C 377..480 CDD:239293 7/22 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..505
Prevents secretion from ER. /evidence=ECO:0000250 502..505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.