DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and Pdia4

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001355685.1 Gene:Pdia4 / 12304 MGIID:104864 Length:699 Species:Mus musculus


Alignment Length:185 Identity:54/185 - (29%)
Similarity:90/185 - (48%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VMFYAP------WCGYCKKTEPIFALVAQAL--HATNVRVGRLDCTKYPAAAKEFKVRGYPTIMF 102
            |:.::|      |||:|||..|.:...|:.|  .:..:.:.::|.|:....||.|.|.||||:..
Mouse   247 VLSFSPRRHSKIWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKI 311

  Fly   103 IKGNMEFTYNGDRGRDELVDYALRMSGPP-VQLVTRTESVDMLKGSHTIFFIFVGQQEG-VVWDT 165
            .:....|.|||.|.:..:|||.:..|||| .:::|..:..:.||....:..|.:.|.:| ..:..
Mouse   312 FRKGRPFDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQ 376

  Fly   166 YYAAAEGYQE-HGFFYATSEDIAAQHFDFEKL---PAVIVYKEE-QHHFYPHGHL 215
            |..||...:| :.|.:..|.:||    .|.|:   ..|:.:.|: |..:.|..|:
Mouse   377 YQDAANNLREDYKFHHTFSPEIA----KFLKVSLGKLVLTHPEKFQSKYEPRFHV 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 29/89 (33%)
ER_PDI_fam 28..>355 CDD:273457 54/185 (29%)
Pdia4NP_001355685.1 pdi_dom 63..164 CDD:273454
ER_PDI_fam 173..691 CDD:273457 54/185 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846783
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.