DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and ERP27

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:181 Identity:40/181 - (22%)
Similarity:62/181 - (34%) Gaps:48/181 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NSMWIFGLISALLLTLGSTGLSSKVLELSDRFIDVR--HEGQWLVMFYAP--WCGYCKKTEPIFA 64
            |::.:|.|:....|.|....:.|.......|||::.  |    :|..|.|  ..|.......|..
Human   104 NTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLH----MVTEYNPVTVIGLFNSVIQIHL 164

  Fly    65 LV----AQALHATNVRVGRLDCTKYPAAAKEFKVRGYPTIMFIKGNMEFTYNGDRGRDELVDYAL 125
            |:    |...:..|:.       :|..|||.|:.:    |:||                |||..:
Human   165 LLIMNKASPEYEENMH-------RYQKAAKLFQGK----ILFI----------------LVDSGM 202

  Fly   126 RMSGPPVQLVTRTESVDMLKGSHTIFFIFVGQQEGVVWDTYYAAAEGYQEH 176
            :.:|..:......||        .:..:.:.|.....||| ...||...||
Human   203 KENGKVISFFKLKES--------QLPALAIYQTLDDEWDT-LPTAEVSVEH 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 23/108 (21%)
ER_PDI_fam 28..>355 CDD:273457 34/157 (22%)
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:372755 40/181 (22%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.