DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5027 and txndc11

DIOPT Version :9

Sequence 1:NP_648847.3 Gene:CG5027 / 39775 FlyBaseID:FBgn0036579 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001313634.1 Gene:txndc11 / 100330433 ZFINID:ZDB-GENE-041008-112 Length:775 Species:Danio rerio


Alignment Length:310 Identity:67/310 - (21%)
Similarity:108/310 - (34%) Gaps:101/310 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SDRFIDVRHEGQ--WLVMFYAPWCGYCKKTEPIFALVA------QALHATNVRVGRLDCTKYPAA 88
            ||.|:....:.|  .|:::|:.|||:|.....:|..:.      :||....|.|||.|      .
Zfish   513 SDSFLQTVMDSQRDVLLLYYSAWCGFCSVLNHVFLQLGRLFRGNRALTVARVNVGRND------L 571

  Fly    89 AKEFKVRGYPTIMFI-----KGNMEFTYNGDRGRDELVDYAL----------RMSGPPVQLVTRT 138
            ..||.|...||::|.     :.:::|..|.......|:.:.|          :.||...:.|...
Zfish   572 PWEFMVDHLPTVLFFPRHRKQMSVKFPENTPMTVPNLLRFVLQHTGHAPWEEQQSGEGEEPVRGE 636

  Fly   139 ESVDMLKG-----SHTIFFIF-----VGQQEGVVW--------DTYYAAAEGYQEHGFFYATSED 185
            |||.:|..     ...:|.:.     |.||..|:|        .|:...::           :::
Zfish   637 ESVSLLGAELRALQQEVFSLHRVRERVSQQLDVLWRENRRLTLHTHTLQSQ-----------NQE 690

  Fly   186 IAAQHFDFEKLPAVIVYKEEQHHFYPHGHLAHEM-DPNEVNETVFQWVNVERFTLFPKVTRFNIH 249
            :.||....|.|     |:|:.|......|...|: |.:|                          
Zfish   691 LQAQIHQLEAL-----YREKTHQLTHTVHRLQELADASE-------------------------- 724

  Fly   250 QLLKTNKYL-VLAVVQEDKLNQIATHELEFRDMVEGVIRKHR--ARYHDK 296
            :|||.|..| ||.....|..::..|.:.:..|        ||  ...||:
Zfish   725 ELLKENTLLKVLLTALSDADHRQTTEDRQTTD--------HRQATEEHDE 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5027NP_648847.3 PDI_a_TMX3 27..128 CDD:239298 28/118 (24%)
ER_PDI_fam 28..>355 CDD:273457 67/310 (22%)
txndc11NP_001313634.1 Thioredoxin_like 56..168 CDD:294274
PDI_b_family 176..282 CDD:239279
PDI_a_PDI_a'_C 508..612 CDD:239293 27/104 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.