DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)72Dn and CG3909

DIOPT Version :9

Sequence 1:NP_001261930.1 Gene:l(3)72Dn / 39774 FlyBaseID:FBgn0263605 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_649969.1 Gene:CG3909 / 41226 FlyBaseID:FBgn0027524 Length:331 Species:Drosophila melanogaster


Alignment Length:253 Identity:52/253 - (20%)
Similarity:95/253 - (37%) Gaps:70/253 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TIKPRE--------IVSLAYSKSSKCLALSRATPV-------------------IELWNLEHAPY 61
            |:|.|.        :||:|.|...:.:|.|.....                   ::||.::.:|.
  Fly    74 TLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLWTVQFSPC 138

  Fly    62 LDRVIHLPTDSHVE----------------------SIAWA--GNRLFSVDLSGKLIEWDVI--K 100
            ...||....|..:.                      |||::  |..:.|..:.|.:..:||.  |
  Fly   139 NKYVISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAGK 203

  Fly   101 LKQRYEHSPTGNAL--WSIDVNPAETDIAIGSEEGHINILSIENDEITYKSLFNKQKGR---VLC 160
            :.|..|    |:|:  .|:..:|....:...|::||:.:.     ::|:..:.....|.   |||
  Fly   204 VVQTLE----GHAMPVRSLCFSPNSQLLLTASDDGHMKLY-----DVTHSDVVGTLSGHASWVLC 259

  Fly   161 IKFDKTGTKLV-TGTEGFVRIWNVLKGTTLHTMTLSEKNVIVWSLQVLSDNTIIAGDS 217
            :.|.:.|.... :.::..|:||:..:...||  |.:|....||.::....|..:|..|
  Fly   260 VAFSEDGKHFASSSSDNSVKIWDTSERKCLH--TFAEHTDQVWGVRYSPGNDKVASAS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)72DnNP_001261930.1 WD40 20..268 CDD:295369 52/253 (21%)
WD40 57..529 CDD:225201 41/193 (21%)
WD40 repeat 74..106 CDD:293791 10/57 (18%)
WD40 repeat 115..151 CDD:293791 6/35 (17%)
WD40 repeat 158..193 CDD:293791 10/35 (29%)
WD40 repeat 283..331 CDD:293791
WD40 repeat 453..489 CDD:293791
WD40 <494..>603 CDD:295369
WD40 repeat 498..536 CDD:293791
CG3909NP_649969.1 WD40 52..323 CDD:238121 52/253 (21%)
WD40 <54..326 CDD:225201 52/253 (21%)
WD40 repeat 89..127 CDD:293791 6/37 (16%)
WD40 repeat 130..166 CDD:293791 6/35 (17%)
WD40 repeat 174..209 CDD:293791 10/34 (29%)
WD40 repeat 215..251 CDD:293791 6/40 (15%)
WD40 repeat 257..293 CDD:293791 11/37 (30%)
WD40 repeat 299..323 CDD:293791 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.