DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)72Dn and F39H12.2

DIOPT Version :9

Sequence 1:NP_001261930.1 Gene:l(3)72Dn / 39774 FlyBaseID:FBgn0263605 Length:699 Species:Drosophila melanogaster
Sequence 2:NP_001362010.1 Gene:F39H12.2 / 185504 WormBaseID:WBGene00018213 Length:347 Species:Caenorhabditis elegans


Alignment Length:213 Identity:43/213 - (20%)
Similarity:87/213 - (40%) Gaps:61/213 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   453 IIFTKQGDLVLL--NPQNNHLSWFTLEEDLVTFKYTIDLSEKCKNTISHVVISSHGEYIVAASSD 515
            ::.|..|::|::  |..:|..|...|:|            .:|  .|:.:....:.|..|:|.|:
 Worm   148 LVGTHTGEIVVIMCNGDSNFSSRKNLKE------------HRC--AITDIATCRYDEITVSADSN 198

  Fly   516 HIISVW---------KLHGKQYKHLLNLPRHRAGTTALSMHEDYPRVVVAYANGQLVEYDLVNRI 571
            ..:.:|         ::..||:.:::|:.|              .:|:|....|.:..|.:....
 Worm   199 GELIIWQKPVKGVNSRVITKQHINVINVLR--------------KQVIVGTLRGIVQYYSVTTGD 249

  Fly   572 FTCETNEYLIPETRRHCINGISLDPQNRNI--------FIV---HT-EGNLYVLE-RDQHLDPKE 623
            ..||.|.:..|      :|.:|:.|::..:        |||   || :.:.|.:| |....||..
 Worm   250 LMCEINAHSRP------VNSVSVAPESAYVLTSSEDGTFIVSKLHTRKPHAYQVEYRFSDSDPSN 308

  Fly   624 LVSNSKSKKLSNGNRSSV 641
            ::..:   :.:||..|::
 Worm   309 VIMGA---QFTNGRGSAI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)72DnNP_001261930.1 WD40 20..268 CDD:295369
WD40 57..529 CDD:225201 17/86 (20%)
WD40 repeat 74..106 CDD:293791
WD40 repeat 115..151 CDD:293791
WD40 repeat 158..193 CDD:293791
WD40 repeat 283..331 CDD:293791
WD40 repeat 453..489 CDD:293791 8/37 (22%)
WD40 <494..>603 CDD:295369 21/125 (17%)
WD40 repeat 498..536 CDD:293791 8/46 (17%)
F39H12.2NP_001362010.1 WD40 <166..294 CDD:392136 31/161 (19%)
WD40 repeat 180..217 CDD:293791 6/36 (17%)
WD40 repeat 225..255 CDD:293791 8/43 (19%)
WD40 repeat 261..302 CDD:293791 11/40 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165435
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.