DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5151 and LDLRAD4

DIOPT Version :10

Sequence 1:NP_648844.1 Gene:CG5151 / 39772 FlyBaseID:FBgn0036576 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_852146.1 Gene:LDLRAD4 / 753 HGNCID:1224 Length:306 Species:Homo sapiens


Alignment Length:185 Identity:47/185 - (25%)
Similarity:63/185 - (34%) Gaps:53/185 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 GC-YKGDCGNSSTGSSCSSLQSHSNDHH------QHYQYQLQQQQTPRCPHHVPLP------DSE 212
            || :..|......|:|.......|.|..      |..::...|...|...|.:.||      |.|
Human   114 GCLWPSDSAAPRLGASEIMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGE 178

  Fly   213 ----YGQDRHLQIRSSYQQSEITRSYTKPPPNKTVRDVP----EQISAGGCGVSSSSYRLTTLQA 269
                |.....||:|...||.|:.|...:.|||:|:.|..    ...|.|.|..||:|        
Human   179 EPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNS-------- 235

  Fly   270 ASSTYTPAGVSVSASSSSSKSKPNAITKFFSRISSPKSPPSCTMTSVATASPASS 324
                    |:|.|..||:            .|:..|  ||  |.:.|....|.:|
Human   236 --------GISASTCSSN------------GRMEGP--PP--TYSEVMGHHPGAS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5151NP_648844.1 None
LDLRAD4NP_852146.1 LDLa 16..47 CDD:238060
PPxY motif 1 180..183 0/2 (0%)
SMAD interaction motif (SIM) 208..211 2/2 (100%)
PPxY motif 2 252..255 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..306
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.