DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5151 and Ldlrad4

DIOPT Version :9

Sequence 1:NP_001246790.1 Gene:CG5151 / 39772 FlyBaseID:FBgn0036576 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001258294.1 Gene:Ldlrad4 / 679578 RGDID:1587105 Length:306 Species:Rattus norvegicus


Alignment Length:143 Identity:37/143 - (25%)
Similarity:50/143 - (34%) Gaps:46/143 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 QQQTPRCPHHVPLP------DSE----YGQDRHLQIRSSYQQSEITRSYTKPPPNKTVRDVP--- 247
            |...|...|.:.||      |.|    |.....||:|...||.|:.|...:.|||:|:.|..   
  Rat   156 QPTYPYVQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLID 220

  Fly   248 -EQISAGGCGVSSSSYRLTTLQAASSTYTPAGVSVSASSSSSKSKPNAITKFFSRISSPKSPPSC 311
             ...:.|.|..||.|                |:|.:..||:            .|:..|  ||  
  Rat   221 ISMYNGGPCPPSSHS----------------GISAATCSSN------------GRMEGP--PP-- 253

  Fly   312 TMTSVATASPASS 324
            |.:.|....|.:|
  Rat   254 TYSEVMGHYPGTS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5151NP_001246790.1 None
Ldlrad4NP_001258294.1 LDLa 16..47 CDD:238060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352377
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.